PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g011016m
Common NameCISIN_1g011016mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 496aa    MW: 54097 Da    PI: 7.2375
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g011016mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.29.9e-40134194262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  orange1.1g011016m 134 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSA 194
                        7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-31131191IPR003851Zinc finger, Dof-type
PfamPF027013.9E-32136192IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.975138192IPR003851Zinc finger, Dof-type
PROSITE patternPS013610140176IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MAEPKDQGIK LFGRTIPLPE VTPSVGAAPS VDDRIDQDPT CSTNSSRESD KSRDGEERDS  60
EKEMSVDKPV ETKQEDEAPP ENSEESTNPG STSGISENPK ASPVEKECTT VKTSKTEEEQ  120
SEPSTSQEKT LKKPDKILPC PRCNSMDTKF CYYNNYNVNQ PRHFCKNCQR YWTAGGTMRN  180
VPVGAGRRKN KNSASHYRHI TVSEALQNVR TDVPNGVHHP ALKTNGTVLT FGSDAPLCES  240
MASVLNIADK TMRNCTRNGF HKPEELRIRL TYRGGENGDN YAHGSPVTVS NSKDEAGKTT  300
SQEAVVQNCQ GFPPHVACFP GAPWPYPWNS AQWSPPVTPP AILPPGFPMP FYPPAAYWGC  360
TVPGAWNIPW IPQPTSPKTP SSAPNSPTLG KHSREESLVK ASNSEGQEQH KENNAERCLW  420
VPKTLRIDDP GDAAKSSIWT TLGIKNDKAD SIGRGGLFKA FQQKNDGRGH IAGTSPVLQA  480
NPAALSRSLN FQESS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.175520.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6300810.0JX630081.1 Citrus reshni ascorbate oxidase gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006431167.10.0hypothetical protein CICLE_v10011556mg
TrEMBLA0A067FZ170.0A0A067FZ17_CITSI; Uncharacterized protein
STRINGVIT_14s0108g00980.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54412848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-109cycling DOF factor 2